Advanced Search



Monoclonal Anti-NR2C2 antibody produced in mouse

SIGMA/WH0007182M1 - clone 2A5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-TAK1; Anti-TR2R1; Anti-TR4; Anti-hTAK1; Anti-nuclear receptor subfamily 2, group C, member 2

MDL Number: MFCD02097469
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007182M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to NR2C2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 μg/mL]
Enhanced Validation-RNAi Western blot analysis of NR2C2 over-expressed 293 cell line, cotransfected with NR2C2 Validated Chimera RNAi. Blot probed with NR2C2 monoclonal antibody, clone 2A5. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of NR2C2 expression in transfected 293T cell line by NR2C2 monoclonal antibody, clone 2A5. Lanes Lane 1: NR2C2 transfected lysate (65.414 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2A5, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_003298 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P49116 
General description: Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes (Yoshikawa et al., 1996 [PubMed 8661150]).[supplied by OMIM
Immunogen: NR2C2 (NP_003289, 43 a.a. ~ 152 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVS
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top