Advanced Search



Monoclonal Anti-UGP2 antibody produced in mouse

SIGMA/WH0007360M1 - clone 3H3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-UDP-glucose pyrophosphorylase 2; Anti-UDPG; Anti-UDPGP2; Anti-UGPP2; Anti-pHC379

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007360M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting UGP2 monoclonal antibody, clone 3H3. Western Blot analysis of UGP2 expression in Raw 264.7.
Western Blotting UGP2 monoclonal antibody, clone 3H3. Western Blot analysis of UGP2 expression in NIH/3T3.
Western Blotting Western Blot analysis of UGP2 expression in transfected 293T cell line by UGP2 monoclonal antibody, clone 3H3. Lanes Lane 1: UGP2 transfected lysate (56.9 kDa). Lane 2: Non-transfected lysate.
Western Blotting UGP2 monoclonal antibody, clone 3H3 Western Blot analysis of UGP2 expression in HeLa.
Enhanced Validation-RNAi Western blot analysis of UGP2 over-expressed 293 cell line, cotransfected with UGP2 Validated Chimera RNAi. Blot probed with UGP2 monoclonal antibody, clone 3H3. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting UGP2 monoclonal antibody, clone 3H3. Western Blot analysis of UGP2 expression in PC-12.
Western Blotting QC Western Blot detection against Immunogen (35.64 kDa).
ELISA Detection limit for recombinant GST tagged UGP2 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3H3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_001001521 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human, rat, mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q16851 
Application: Monoclonal Anti-UGP2 antibody produced in mouse has been used in Western blotting.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The UDP-glucose pyrophosphorylase 2 (UGP2 ) gene is localized on human chromosome 2p15. It has a crucial role in carbohydrate metabolism. Its product uridine diphosphate-glucose (UDP-glucose) acts as a precursor for sugar nucleotides and is involved in various pathways. The enzyme is involved in the conversion of glucose-1-phosphate and MgUTP to UDP-glucose and MgPPi.
Immunogen: UGP2 (NP_001001521, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDNI
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top