Advanced Search



Monoclonal Anti-VRK1 antibody produced in mouse

SIGMA/WH0007443M2 - clone 4F9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-MGC117401; Anti-MGC138280; Anti-vaccinia related kinase 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007443M2-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to VRK1 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of VRK1 expression in transfected 293T cell line by VRK1 monoclonal antibody, clone 4F9. Lanes Lane 1: VRK1 transfected lysate (45.5 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of VRK1 over-expressed 293 cell line, cotransfected with VRK1 Validated Chimera RNAi. Blot probed with VRK1 monoclonal antibody (M02) clone 4F9. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
Immunoprecipitation Immunoprecipitation of VRK1 transfected lysate using anti-VRK1 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with VRK1 monoclonal antibody.
ELISA Detection limit for recombinant GST tagged VRK1 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4F9, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_003384 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q99986 
General description: This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN. (provided by RefSeq)
Immunogen: VRK1 (NP_003375, 287 a.a. ~ 396 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLKAKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top