Advanced Search



Monoclonal Anti-XRCC5 antibody produced in mouse

SIGMA/WH0007520M2 - clone 3D8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-KARP1; Anti-KU80; Anti-Ku86; Anti-NFIV; Anti-X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining; Ku autoantigen, 80kDa)

MDL Number: MFCD01633955
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007520M2-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to XRCC5 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to XRCC5 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of XRCC5 expression in transfected 293T cell line by XRCC5 monoclonal antibody, clone 3D8. Lanes Lane 1: XRCC5 transfected lysate (82.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting XRCC5 monoclonal antibody, clone 3D8. Western Blot analysis of XRCC5 expression in A-431.
Western Blotting QC Western Blot detection against Immunogen (106.26 kDa).
ELISA Detection limit for recombinant GST tagged XRCC5 is 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3D8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC019027 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P13010 
Biochem/physiol Actions: The gene XRCC5 (X-ray repair cross complementing 5) is mapped to human chromosome 2q35. It is part of the non-homologous end joining double-strand break repair pathway. XRCC5 helps in damage recognition. Mutations in the gene are associated with risk of glioma and chronic obstructive pulmonary disease (COPD). Mutation in it might also be linked with gastric cancer development, particularly in cases of family history. XRCC5 is also involved in alcohol dependence. In addition, it is a part of the OCFRE (osteocalcin (OC) fibroblast growth factor (FGF) response element (FRE))-binding complex, thereby controlling the gene expression of osteocalcin.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The protein encoded by this gene is the 80-kilodalton subunit of the Ku heterodimer protein which is also known as ATP-dependant DNA helicase II or DNA repair protein XRCC5. Ku is the DNA-binding component of the DNA-dependent protein kinase, and it functions together with the DNA ligase IV-XRCC4 complex in the repair of DNA double-strand break by non-homologous end joining and the completion of V(D)J recombination events. This gene functionally complements Chinese hamster xrs-6, a mutant defective in DNA double-strand break repair and in ability to undergo V(D)J recombination. A rare microsatellite polymorphism in this gene is associated with cancer in patients of varying radiosensitivity. (provided by RefSeq)
Immunogen: XRCC5 (AAH19027.1, 1 a.a. ~ 732 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFGTDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADSLDALIVSMDVIQHETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGDGPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKIERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDDDETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQVLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLVYVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTTKIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLIEAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRVLVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLKALQEKVEIKQLNHFWEIVVQDGIALITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFEEGGDVDDLLDMI
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top