Advanced Search



Monoclonal Anti-CXCR4 antibody produced in mouse

SIGMA/WH0007852M2 - clone 1F8, ascites fluid

Synonym: Anti-CD184; Anti-D2S201E; Anti-FB22; Anti-HM89; Anti-HSY3RR; Anti-LAP3; Anti-LCR1; Anti-LESTR; Anti-NPY3R; Anti-NPYR; Anti-NPYRL; Anti-NPYY3R; Anti-WHIM; Anti-chemokine (C-X-C motif) receptor 4

MDL Number: MFCD01092337
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007852M2-200UL 200 µL
$524.00
1/EA
Add To Favorites
Western Blotting CXCR4 monoclonal antibody, clone 1F8. Western Blot analysis of CXCR4 expression in human Intestinal wall.
Western Blotting QC Western Blot detection against Immunogen (30.8 kDa).

 

antibody form ascites fluid
antibody product type primary antibodies
biological source mouse
clone 1F8, monoclonal
conjugate unconjugated
GenBank® accession no. BC020968 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1:500-1:1000
UniProt accession no. P61073 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)
Immunogen: CXCR4 (AAH20968, 1 a.a. ~ 46 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYS
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top