Advanced Search



Monoclonal Anti-FZD5 antibody produced in mouse

SIGMA/WH0007855M1 - clone 6A3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-HFZ5; Anti-frizzled homolog 5 (Drosophila)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007855M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Proximity Ligation Assay Proximity Ligation Analysis of protein-protein interactions between WNT5A and FZD5. HeLa cells were stained with anti-WNT5A rabbit purified polyclonal 1:1200 and anti-FZD5 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Western Blotting Western Blot analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody, clone 6A3. Lanes Lane 1: FZD5 transfected lysate (64.5 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (35.64 kDa).
Immunoprecipitation Immunoprecipitation of FZD5 transfected lysate using anti-FZD5 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with FZD5 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged FZD5 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 6A3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_003468 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  proximity ligation assay: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q13467 
Biochem/physiol Actions: Frizzled class receptor 5 (FZD5) is a receptor component for the canonical and non-canonical Wnt signaling pathways, which is necessary for cell proliferation and cell differentiation. It might serve as an important biomarker for eye malformation. The Wnt5a-FZD5 complex is known to support the functions of innate immunity. Fzd5, along with GCM1 (chorion-specific transcription factor), is involved in a feedback mechanism that regulates trophoblast differentiation and chorionic branching in placenta.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The frizzled class receptor 5 (FZD5) gene encodes a receptor FZ5 for Wnt proteins and it is localized on human chromosome 2q33.3.
Immunogen: FZD5 (ENSP00000354607, 72 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top