Advanced Search



Monoclonal Anti-MAPKAPK3 antibody produced in mouse

SIGMA/WH0007867M1 - clone 3F4, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-3PK; Anti-MAPKAP3; Anti-mitogen-activated protein kinase-activated protein kinase 3

MDL Number: MFCD01633617
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0007867M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of MAPKAPK3 expression in transfected 293T cell line by MAPKAPK3 monoclonal antibody, clone 3F4. Lanes Lane 1: MAPKAPK3 transfected lysate (Predicted MW: 43 kDa). Lane 2: Non-transfected lysate.
Western Blotting MAPKAPK3 monoclonal antibody, clone 3F4. Western Blot analysis of MAPKAPK3 expression in NIH/3T3.
Western Blotting MAPKAPK3 monoclonal antibody, clone 3F4 Western Blot analysis of MAPKAPK3 expression in HeLa.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
Immunoprecipitation Immunoprecipitation of MAPKAPK3 transfected lysate using anti-MAPKAPK3 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with MAPKAPK3 monoclonal antibody.
ELISA Detection limit for recombinant GST tagged MAPKAPK3 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3F4, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC001662 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity mouse
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q3UMW7 
General description: This gene encodes a member of the Ser/Thr protein kinase family. This kinase functions as a mitogen-activated protein kinase (MAP kinase)- activated protein kinase. MAP kinases are also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals. This kinase was shown to be activated by growth inducers and stress stimulation of cells. In vitro studies demonstrated that ERK, p38 MAP kinase and Jun N-terminal kinase were all able to phosphorylate and activate this kinase, which suggested the role of this kinase as an integrative element of signaling in both mitogen and stress responses. This kinase was reported to interact with, phosphorylate and repress the activity of E47, which is a basic helix-loop-helix transcription factor known to be involved in the regulation of tissue-specific gene expression and cell differentiation. (provided by RefSeq)
Immunogen: MAPKAPK3 (AAH01662, 272 a.a. ~ 382 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EVSEDAKQLIRLLLKTDPTERLTITQFMNHPWINQSMVVPQTPLHTARVLQEDKDHWDEVKEEMTSALATMRVDYDQVKIKDLKTSNNRLLNKRRKKQAGSSSASQGCNNQ
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top