Advanced Search



Monoclonal Anti-GCM1 antibody produced in mouse

SIGMA/WH0008521M3 - clone 3G7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-GCMA; Anti-glial cells missing homolog 1 (Drosophila); Anti-hGCMa

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0008521M3-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to GCM1 on HeLa cell. [antibody concentration 10 μg/mL]
ELISA Detection limit for recombinant GST tagged GCM1 is approximately 3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3G7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_003643 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
UniProt accession no. Q9NP62 
Biochem/physiol Actions: GCM1 (glial cells missing homolog 1) is a transcription factor that is specific for placenta. It plays an important role in trophoblast cell fusion and invasion by enhancing the expression of syncytin-1 and syncytin-2 fusogenic proteins and high-temperature requirement protein A4 (HtrA4), a serine protease. Disruption in the activity of this gene can result in defective placental development, thereby leading to embryonic death.
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: The gene GCM1 (glial cells missing homolog 1) is mapped to human chromosome 6p12. It belongs to the glial cells missing (GCM) family. GCM1 is present in villous cytotrophoblast cells, the syncytiotrophoblast layer and extravillous trophoblast cells.
Immunogen: GCM1 (NP_003634, 108 a.a. ~ 166 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top