Advanced Search



Monoclonal Anti-FAM50A antibody produced in mouse

SIGMA/WH0009130M2 - clone 5F10, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-9F; Anti-DXS9928E; Anti-HXC26; Anti-XAP5; Anti-family with sequence similarity 50, member A

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0009130M2-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to FAM50A on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 0.5 μg/mL]
Western Blotting FAM50A monoclonal antibody, clone 5F10 Western Blot analysis of FAM50A expression in HeLa S3 NE.
Western Blotting FAM50A monoclonal antibody, clone 5F10. Western Blot analysis of FAM50A expression in PC-12.
Western Blotting QC Western Blot detection against Immunogen (35.42 kDa).
ELISA Detection limit for recombinant GST tagged FAM50A is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 5F10, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_004699 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity rat, human, mouse
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q14320 
General description: This gene belongs to the FAM50 family. The encoded protein is highly conserved in length and sequence across different species. It is a basic protein containing a nuclear localization signal, and may function as a DNA-binding protein or a transcriptional factor. (provided by RefSeq)
Immunogen: FAM50A (NP_004690, 1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAQYKGAASEAGRAMHLMKKREKQREQMEQMKQRIAEENIMKSNIDKKFSAHYDAVEAELKSSTVGLVTLNDMKAKQEALVKEREKQL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top