Advanced Search



Monoclonal Anti-PSCD3 antibody produced in mouse

SIGMA/WH0009265M1 - clone 6D3-1A9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ARNO3; Anti-GRP1; Anti-pleckstrin homology, Sec7 and coiled-coil domains 3

MDL Number: MFCD03457556
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0009265M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to PSCD3 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting PSCD3 monoclonal antibody, clone 6D3-1A9 Western Blot analysis of PSCD3 expression in HeLa S3 NE.
Western Blotting Western Blot analysis of PSCD3 expression in transfected 293T cell line by PSCD3 monoclonal antibody, clone 6D3-1A9. Lanes Lane 1: PSCD3 transfected lysate (46.3 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (45.8 kDa).
ELISA Detection limit for recombinant GST tagged PSCD3 is approximately 3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 6D3-1A9, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC008191 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O43739 
General description: This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The coiled-coil motif is involved in homodimerization, the Sec7 domain contains guanine-nucleotide exchange protein (GEP) activity, and the PH domain interacts with phospholipids and is responsible for association of PSCDs with membranes. Members of this family appear to mediate the regulation of protein sorting and membrane trafficking. This encoded protein is involved in the control of Golgi structure and function, and it may have a physiological role in regulating ADP-ribosylation factor protein 6 (ARF) functions, in addition to acting on ARF1. (provided by RefSeq)
Immunogen: PSCD3 (AAH08191, 1 a.a. ~ 180 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK*
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top