Advanced Search



Monoclonal Anti-GRAP2 antibody produced in mouse

SIGMA/WH0009402M1 - clone 1G12, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-GADS; Anti-GRAP2; Anti-GRB2-related adaptor protein 2; Anti-GRB2L; Anti-GRBLG; Anti-GRID; Anti-GRPL; Anti-GrbX; Anti-Grf40; Anti-Mona; Anti-P38

MDL Number: MFCD03455450
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0009402M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to GRAP2 on formalin-fixed paraffin-embedded human spleen. [antibody concentration 3 μg/mL]
Western Blotting Western Blot analysis of GRAP2 expression in transfected 293T cell line by GRAP2 monoclonal antibody, clone 1G12. Lanes Lane 1: GRAP2 transfected lysate (38 kDa). Lane 2: Non-transfected lysate.
Western Blotting GRAP2 monoclonal antibody, clone 1G12 Western Blot analysis of GRAP2 expression in Jurkat.
Western Blotting QC Western Blot detection against Immunogen (35.64 kDa).
Immunoprecipitation Immunoprecipitation of GRAP2 transfected lysate using anti-GRAP2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with GRAP2 monoclonal antibody.
ELISA Detection limit for recombinant GST tagged GRAP2 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1G12, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC025692 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O75791 
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist. (provided by RefSeq)
Immunogen: GRAP2 (AAH25692, 226 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHN
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top