Advanced Search



Monoclonal Anti-CRSP8 antibody produced in mouse

SIGMA/WH0009442M1 - clone 8B8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CRAP34; Anti-CRSP34; Anti-MED27; Anti-MGC11274; Anti-TRAP37; Anti-cofactor required for Sp1 transcriptional activation, subunit 8, 34kDa

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0009442M1-50UG 50 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to CRSP8 on formalin-fixed paraffin-embedded human colon. [antibody concentration 0.3 μg/mL]
Western Blotting Western Blot analysis of CRSP8 expression in transfected 293T cell line by CRSP8 monoclonal antibody, clone 8B8. Lanes Lane 1: CRSP8 transfected lysate (35.4 kDa). Lane 2: Non-transfected lysate.
Western Blotting CRSP8 monoclonal antibody, clone 8B8 Western Blot analysis of CRSP8 expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (33.44 kDa).
ELISA Detection limit for recombinant GST tagged MED27 is 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 8B8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC002878 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q6P2C8 
General description: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. (provided by RefSeq)
Immunogen: CRSP8 (AAH02878, 1 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MRNKETLEGREKAFIAHFQDNLHSVNRDLNELERLSNLVGKPSENHPLHNSGLLSLDPVQDKTPLYSQLL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top