Advanced Search



Monoclonal Anti-CRSP9 antibody produced in mouse

SIGMA/WH0009443M1 - clone 3E7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CRSP33; Anti-MED7; Anti-MGC12284; Anti-cofactor required for Sp1 transcriptional activation, subunit 9, 33kDa

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0009443M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of CRSP9 expression in transfected 293T cell line by CRSP9 monoclonal antibody, clone 3E7. Lanes Lane 1: CRSP9 transfected lysate (27.2 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of CRSP9 over-expressed 293 cell line, cotransfected with CRSP9 Validated Chimera RNAi. Blot probed with CRSP9 monoclonal antibody, clone 3E7. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting CRSP9 monoclonal antibody, clone 3E7 Western Blot analysis of CRSP9 expression in Jurkat.
Western Blotting QC Western Blot detection against Immunogen (51.37 kDa).
ELISA Detection limit for recombinant GST tagged CRSP9 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3E7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC005250 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O43513 
General description: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. Two transcript variants encoding the same protein have been found for this gene. (provided by RefSeq)
Immunogen: CRSP9 (AAH05250, 1 a.a. ~ 233 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHSEAGMRVKTEPMDADDSNNCTGQNEHQRENSGHRRDQIIEKDAALCVLIDEMNERP
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top