Advanced Search



Monoclonal Anti-HAND2 antibody produced in mouse

SIGMA/WH0009464M1 - clone 4H8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-DHAND2; Anti-Hed; Anti-MGC125303; Anti-MGC125304; Anti-Thing2; Anti-dHand; Anti-heart and neural crest derivatives expressed 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0009464M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of HAND2 expression in transfected 293T cell line by HAND2 monoclonal antibody, clone 4H8. Lanes Lane 1: HAND2 transfected lysate (21.6 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (34.76 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4H8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_021973 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. P61296 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. (provided by RefSeq)
Immunogen: HAND2 (NP_068808.1, 135 a.a. ~ 216 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top