Advanced Search



Monoclonal Anti-SPAG6 antibody produced in mouse

SIGMA/WH0009576M1 - clone 3E3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-DKFZp434I153; Anti-MGC26276; Anti-ReproSA1; Anti-pf16; Anti-sperm associated antigen 6

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0009576M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Western Blotting SPAG6 monoclonal antibody, clone 3E3 Western Blot analysis of SPAG6 expression in A-431.
Western Blotting QC Western Blot detection against Immunogen (37.11 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3E3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_012443 
isotype IgG3κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O75602 
General description: The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. The protein expressed by this gene is recognized by anti-sperm antibodies from an infertile man. This protein localizes to the tail of permeabilized human sperm and contains eight contiguous armadillo repeats, a motif known to mediate protein-protein interactions. Studies in mice suggest that this protein is involved in sperm flagellar motility and maintenance of the structural integrity of mature sperm. Alternatively spliced variants that encode different protein isoforms have been described but the full-length sequences of only two have been determined. (provided by RefSeq)
Immunogen: SPAG6 (NP_036575, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSQRQVLQVFEQYQKARTQFVQMVAELATRPQNIETLQNAGVMSLLRTLLLDVVPTIQQTAALALGRLANYNDDLAEAVVKCDILPQLVYSLAEQNRFYK
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top