Advanced Search



Monoclonal Anti-IKBKE antibody produced in mouse

SIGMA/WH0009641M2 - clone 2F1, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-IKKE; Anti-IKKI; Anti-IKKi; Anti-KIAA0151; Anti-MGC125294; Anti-MGC125295; Anti-MGC125297; Anti-inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase epsilon

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0009641M2-100UG 100 µg
$524.00
1/EA
Add To Favorites
ELISA Detection limit for recombinant GST tagged IKBKE is 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2F1, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_014002 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
UniProt accession no. Q14164 
Biochem/physiol Actions: Inhibitor of κ light polypeptide gene enhancer in B-cells, kinase ε (IKKε) mainly activates the canonical nuclear factor-κB (NF-κB) pathway induced by interferon, phorbol 12-myristate 13-acetate, or the T-cell receptor. Overexpression of IKKε is associated with the pathogenesis of a subset of breast tumors and ovarian cancer. IKBKE also acts as a potential therapeutic target for these malignancies. IKKε plays a vital role in regulation of immune response. IKKε is an essential constituent of a novel IκB kinase complex, which is mainly implicated in the degradation of IκBα in response to either phorbol esters (PMA) or to T cell receptor activation. IKKε activated by interferon-β (IFNβ), directly phosphorylates signal transducer and activator of transcription 1 (STAT1), a component of interferon-stimulated gene factor 3 complex (ISGF3), and thus, plays a vital role in IFN-inducible antiviral transcriptional response.
General description: Inhibitor of κ light polypeptide gene enhancer in B-cells, kinase ε (IKKε ) is encoded by the gene mapped to human chromosome 1q32.1. IKKε is a serine/threonine protein kinase, which belongs to the non-canonical IκB kinase family. IKKε is an ~85kDa protein characterized with kinase domain close to N-terminal end, coiled-coil motif, and putative helix-loop-helix (HLH) motif close to C-terminal end.
Immunogen: IKBKE (NP_054721, 541 a.a. ~ 640 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QQIQCYLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKYQASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQE
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top