Advanced Search



Monoclonal Anti-TOMM20 antibody produced in mouse

SIGMA/WH0009804M1 - clone 4F3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-KIAA0016; Anti-MAS20; Anti-MGC117367; Anti-MOM19; Anti-TOM20; Anti-translocase of outer mitochondrial membrane 20 homolog (yeast)

MDL Number: MFCD04118702
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0009804M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunocytochemistry-immunoflourescence JOURNAL CITATION: Mouse Tmem135 mutation reveals a mechanism involving mitochondrial dynamics that leads to age-dependent retinal pathologies. By: Lee, W. H., Higuchi, H., et al. in Elife, 2016. PubMed ID: 27863209 Image collected and cropped by CiteAb from the following publication, (https://elifesciences.org/articles/19264), provided under a CC-BY license. Image might reflect a new usage that is not reflected in claims on product description or independently verified by Merck KGaA, Darmstadt, Germany. For Research Use Only. Not for use in diagnostic procedures.
Immunohistochemistry Immunoperoxidase of monoclonal antibody to TOMM20 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to TOMM20 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting TOMM20 monoclonal antibody, clone 4F3. Western Blot analysis of TOMM20 expression in PC-12.
Western Blotting Western Blot analysis of TOMM20 expression in transfected 293T cell line by TOMM20 monoclonal antibody, clone 4F3. Lanes Lane 1: TOMM20 transfected lysate (16.3 kDa). Lane 2: Non-transfected lysate.
Western Blotting TOMM20 monoclonal antibody, clone 4F3 Western Blot analysis of TOMM20 expression in HeLa.
Western Blotting TOMM20 monoclonal antibody, clone 4F3. Western Blot analysis of TOMM20 expression in NIH/3T3.
Western Blotting TOMM20 monoclonal antibody, clone 4F3. Western Blot analysis of TOMM20 expression in rat testis.
Western Blotting TOMM20 monoclonal antibody, clone 4F3. Western Blot analysis of TOMM20 expression in rat brain.
Western Blotting QC Western Blot detection against Immunogen (41.69 kDa).
ELISA Detection limit for recombinant GST tagged TOMM20 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4F3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC066335 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human, mouse, rat
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q15388 
Biochem/physiol Actions: Translocase of outer mitochondrial membrane 20 (TOMM20) is a subunit of multiple component- dynamic complex, which plays a vital role in importing certain cytosolic proteins into or through the outer membrane of the mitochondria. It acts as a receptor for precursor proteins containing N-terminal cleavable presequences targeted to the mitochondria. Nuclear respiratory factor 2(NRF-2) plays an essential role in regulating transcription of the human TOMM20 gene. TOMM20 has potential as a prognostic biomarker and therapeutic target for gastric cancer. TOMM20 serve as a marker for mitochondrial protein import in inner ear, and reduced expression of TOMM20 is associated with Meniere′s disease.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Translocase of outer mitochondrial membrane 20 (TOMM20) is a 20kb gene with five exons and four introns, and is mapped to human chromosome 1q42.3. This gene codes for a TOMM20 receptor, which is a subunit of the outer mitochondrial membrane translocase. TOMM20 receptor contains a membrane anchor domain and a cytosolic domain, and is predominantly expressed in human cochlea.
Immunogen: TOMM20 (AAH66335, 1 a.a. ~ 145 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top