Advanced Search



Monoclonal Anti-ABCF2 antibody produced in mouse

SIGMA/WH0010061M1 - clone 1D11, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ABC28; Anti-ATP-binding cassette, sub-family F (GCN20), member 2; Anti-DKFZp586K1823; Anti-EST133090; Anti-HUSSY18; Anti-MABC1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0010061M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to ABCF2 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 μg/mL]
Western Blotting Western Blot analysis of ABCF2 expression in transfected 293T cell line by ABCF2 monoclonal antibody, clone 1D11. Lanes Lane 1: ABCF2 transfected lysate (68.53 kDa). Lane 2: Non-transfected lysate.
Western Blotting ABCF2 monoclonal antibody, clone 1D11 Western Blot analysis of ABCF2 expression in HeLa.
Enhanced Validation-RNAi Western blot analysis of ABCF2 over-expressed 293 cell line, cotransfected with ABCF2 Validated Chimera RNAi. Blot probed with ABCF2 monoclonal antibody, clone 1D11. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (37.73 kDa).
Immunoprecipitation Immunoprecipitation of ABCF2 transfected lysate using anti-ABCF2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with ABCF2 monoclonal antibody.
ELISA Detection limit for recombinant GST tagged ABCF2 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1D11, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC001661 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q9UG63 
Biochem/physiol Actions: ATP binding cassette subfamily F member 2 (ABCF2) has been shown to bind to a-actinin-4 (ACTN4). It suppresses the activity of a channel named volume-sensitive outwardly rectifying anion channel (VSOR), which takes part in the efflux of chloride ions in epithelial cells. It has been reported that ABCF2 may be a prognostic marker for ovarian clear cell ovarian adenocarcinoma.
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This protein is a member of the GCN20 subfamily. Alternative splicing of this gene results in multiple transcript variants. (provided by RefSeq)
Immunogen: ABCF2 (AAH01661, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPSDLAKKKAAKKKEAAKARQRPRKGHEENGDVVTEPQVAEKNEANGRETTEVDLLTKELEDFEMKKAAARAVTGVLASHPNSTDVHIINLSLTFHGQELLSDTKLELNS
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top