Advanced Search



Monoclonal Anti-CLEC4M antibody produced in mouse

SIGMA/WH0010332M1 - clone 2G1, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-C-type lectin domain family 4, member M; Anti-CD209L; Anti-CD299; Anti-DCSIGN2; Anti-DCSIGNR; Anti-HP10347; Anti-LSIGN; Anti-MGC129964; Anti-MGC47866

MDL Number: MFCD03701938
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0010332M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of CLEC4M expression in transfected 293T cell line by CLEC4M monoclonal antibody, clone 2G1. Lanes Lane 1: CLEC4M transfected lysate (Predicted MW: 12.21 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2G1, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_014257 
isotype IgG3λ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q9H2X3 
General description: This gene encodes a transmembrane receptor and is often referred to as L-SIGN because of its expression in the endothelial cells of the lymph nodes and liver. The encoded protein is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens ranging from parasites to viruses, with a large impact on public health. The protein is organized into three distinct domains: an N-terminal transmembrane domain, a tandem-repeat neck domain and C-type lectin carbohydrate recognition domain. The extracellular region consisting of the C-type lectin and neck domains has a dual function as a pathogen recognition receptor and a cell adhesion receptor by binding carbohydrate ligands on the surface of microbes and endogenous cells. The neck region is important for homo-oligomerization which allows the receptor to bind multivalent ligands with high avidity. Variations in the number of 23 amino acid repeats in the neck domain of this protein are common and have a significant impact on ligand binding ability. This gene is closely related in terms of both sequence and function to a neighboring gene (GeneID 30835; often referred to as DC-SIGN or CD209). DC-SIGN and L-SIGN differ in their ligand-binding properties and distribution. Alternative splicing results in multiple variants
Immunogen: CLEC4M (NP_055072, 285 a.a. ~ 394 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAA
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top