Advanced Search



Monoclonal Anti-YAP1 antibody produced in mouse

SIGMA/WH0010413M1 - clone 2F12, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-YAP; Anti-YAP2; Anti-YAP65; Anti-Yes-associated protein 1, 65kDa

MDL Number: MFCD04118707
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0010413M1-100UG 100 µg
$609.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to YAP1 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to YAP1 on HeLa cell. [antibody concentration 30 μg/mL]
Western Blotting Western Blot analysis of YAP1 expression in transfected 293T cell line by YAP1 monoclonal antibody, clone 2F12. Lanes Lane 1: YAP1 transfected lysate (Predicted MW: 54.5 kDa). Lane 2: Non-transfected lysate.
Western Blotting YAP1 monoclonal antibody, clone 2F12. Western Blot analysis of YAP1 expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (37.73 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2F12, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_006106 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) ELISA: suitable
  immunofluorescence: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  western blot: 1-5 μg/mL
UniProt accession no. P46937 
Application: Monoclonal Anti-YAP1 antibody produced in mouse has been used in western blotting and co-immunoprecipitation.
Biochem/physiol Actions: Yes-associated protein 1 (YAP1) promotes cell and tissue growth. It interacts with receptor tyrosine-protein kinase (ErbB4) receptor and regulates transcription. YAP1 is an oncogenic protein and contributes to tumor progression. It is highly expressed in hedgehog-associated medulloblastomas and mutations in YAP1 is also implicated in optic fissure closure defects. Knockdown of YAP1 gene has been shown to lead to apoptosis of prostate cancer cells and is considered as a potential target for treatment.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes the human ortholog of chicken YAP protein which binds to the SH3 domain of the Yes proto-oncogene product. This protein contains a WW domain that is found in various structural, regulatory and signaling molecules in yeast, nematode, and mammals, and may be involved in protein-protein interaction. (provided by RefSeq)
General description: Yes-associated protein 1 (YAP1) is a transcriptional coactivator. It possesses two WW domains, a TID domain (TEA domain family member 1 transcription factor interacting-domain), sarcoma homology 3 domain (SH3) binding motif, a proline rich region and a PDZ motif. It is expressed in eight isoforms. The YAP1 gene is localized on human chromosome 11q22.1.
Immunogen: YAP1 (NP_006097, 53 a.a. ~ 161 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top