Advanced Search



Monoclonal Anti-CCT7 antibody produced in mouse

SIGMA/WH0010574M1 - clone 1D6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CCTETA; Anti-Ccth; Anti-MGC110985; Anti-Nip71; Anti-TCP1eta; Anti-chaperonin containing TCP1, subunit 7 (eta)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0010574M1-100UG 100 µg
$406.00
1/EA
Add To Favorites
Western Blotting CCT7 monoclonal antibody, clone 1D6. Western Blot analysis of CCT7 expression in PC-12.
Western Blotting CCT7 monoclonal antibody, clone 1D6. Western Blot analysis of CCT7 expression in human pancreas.
Western Blotting CCT7 monoclonal antibody, clone 1D6. Western Blot analysis of CCT7 expression in NIH/3T3.
Western Blotting CCT7 monoclonal antibody, clone 1D6. Western Blot analysis of CCT7 expression in 293.
Western Blotting CCT7 monoclonal antibody, clone 1D6 Western Blot analysis of CCT7 expression in HL-60.
Western Blotting CCT7 monoclonal antibody, clone 1D6. Western Blot analysis of CCT7 expression in Raw 264.7.
Western Blotting CCT7 monoclonal antibody, clone 1D6. Western Blot analysis of CCT7 expression in K-562.
Western Blotting Western Blot analysis of CCT7 expression in transfected 293T cell line by CCT7 monoclonal antibody, clone 1D6. Lanes Lane 1: CCT7 transfected lysate (59.4 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.07 kDa).
ELISA Detection limit for recombinant GST tagged CCT7 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1D6, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. BC019296 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q99832 
General description: This gene encodes a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants encoding different isoforms have been found for this gene, but only two of them have been characterized to date. (provided by RefSeq)
Immunogen: CCT7 (AAH19296, 425 a.a. ~ 528 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDINNEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVD
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top