Advanced Search



Monoclonal Anti-TRIM16 antibody produced in mouse

SIGMA/WH0010626M1 - clone 5F4, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-EBBP; Anti-tripartite motif-containing 16

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0010626M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Enhanced Validation-RNAi Western blot analysis of TRIM16 over-expressed 293 cell line, cotransfected with TRIM16 Validated Chimera RNAi. Blot probed with TRIM16 monoclonal antibody, clone 5F4. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of TRIM16 expression in transfected 293T cell line by TRIM16 monoclonal antibody, clone 5F4. Lanes Lane 1: TRIM16 transfected lysate (64 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.73 kDa).
Immunoprecipitation Immunoprecipitation of TRIM16 transfected lysate using anti-TRIM16 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with TRIM16 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged TRIM16 is approximately 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 5F4, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_006470 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O95361 
Biochem/physiol Actions: The gene TRIM16 (tripartite motif containing 16), also referred to as estrogen-responsive B box protein (EBBP), encodes a protein that has the ability to heterodimerize with other TRIM proteins and also has E3 ubiquitin ligase activity. It is found to positively regulate transcriptional regulator of the retinoic acid receptor β2 (RARβ2) gene. Overexpression of trim16 facilitates retinoid-induced differentiation, reduces neuroblastoma cell growth, migration, and considerably decreases tumorigenicity in vivo.
General description: This gene was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined. (provided by RefSeq)
Immunogen: TRIM16 (NP_006461, 165 a.a. ~ 273 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGELLAAVRKAQANVMLFLEEKEQAALSQANGIKAHLEYRSAEMEKSKQELERMA
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top