Advanced Search



Monoclonal Anti-CAMKK2 antibody produced in mouse

SIGMA/WH0010645M1 - clone 1A11, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CAMKK; Anti-CAMKKB; Anti-KIAA0787; Anti-MGC15254; Anti-calcium/calmodulin-dependent protein kinase kinase 2, beta

MDL Number: MFCD02262656
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0010645M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting CAMKK2 monoclonal antibody, clone 1A11 Western Blot analysis of CAMKK2 expression in IMR-32.
Western Blotting Western Blot analysis of CAMKK2 expression in transfected 293T cell line by CAMKK2 monoclonal antibody, clone 1A11. Lanes Lane 1: CAMKK2 transfected lysate (59.6 kDa). Lane 2: Non-transfected lysate.
Western Blotting CAMKK2 monoclonal antibody, clone 1A11. Western Blot analysis of CAMKK2 expression in K-562.
Western Blotting QC Western Blot detection against Immunogen (39.93 kDa).
Immunoprecipitation Immunoprecipitation of CAMKK2 transfected lysate using anti-CAMKK2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with CAMKK2 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged CAMKK2 is approximately 1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1A11, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC026060 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q96RR4 
General description: The product of this gene belongs to the Serine/Threonine protein kinase family, and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. This protein plays a role in the calcium/calmodulin-dependent (CaM) kinase cascade by phosphorylating the downstream kinases CaMK1 and CaMK4. Seven transcript variants encoding six distinct isoforms have been identified for this gene. Additional splice variants have been described but their full-length nature has not been determined. The identified isoforms exhibit a distinct ability to undergo autophosphorylation and to phosphorylate the downstream kinases. (provided by RefSeq)
Immunogen: CAMKK2 (AAH26060, 1 a.a. ~ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLARDRPLEADGQEVPLDSSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSP
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top