Advanced Search



Monoclonal Anti-TRAF3IP2 antibody produced in mouse

SIGMA/WH0010758M1 - clone 4A3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ACT1; Anti-C6orf4; Anti-C6orf5; Anti-C6orf6; Anti-CIKS; Anti-DKFZP586G0522; Anti-MGC3581; Anti-TRAF3 interacting protein 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0010758M1-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to TRAF3IP2 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to TRAF3IP2 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting TRAF3IP2 monoclonal antibody, clone 4A3 Western Blot analysis of TRAF3IP2 expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (38.39 kDa).
ELISA Detection limit for recombinant GST tagged TRAF3IP2 is approximately 1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4A3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC002823 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O43734 
Biochem/physiol Actions: TRAF3 interacting protein 2 (TRAF3IP2) stimulates aldosterone-induced cardiomyocyte growth, fibroblast migration and proliferation in vivo. TRAF3IP2 is a promising therapeutic target in hypertensive heart disease. The encoded protein plays a vital role in activation of nuclear transcription factor-κB (NF-κB) and JNK (c-Jun N-terminal kinase) signaling during immune response to pathogens, inflammatory signals and autoimmunity in mammals. Mutation of the gene is associated with psoriasis, psoriatic arthritis and Steven-Johnson syndrome (SJS), and toxic epidermal necrolysis (TEN) susceptibility. Variation in the TRAF3IP2 gene leads to cutaneous extraintestinal manifestations in inflammatory bowel disease(IBD).
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: This gene encodes a protein involved in regulating responses to cytokines by members of the Rel/NF-kappaB transcription factor family. These factors play a central role in innate immunity in response to pathogens, inflammatory signals and stress. This gene product interacts with TRAF proteins (tumor necrosis factor receptor-associated factors) and either I-kappaB kinase or MAP kinase to activate either NF-kappaB or Jun kinase. Several alternative transcripts encoding different isoforms have been identified. Another transcript, which does not encode a protein and is transcribed in the opposite orientation, has been identified. Overexpression of this transcript has been shown to reduce expression of at least one of the protein encoding transcripts, suggesting it has a regulatory role in the expression of this gene. (provided by RefSeq)
Immunogen: TRAF3IP2 (AAH02823, 451 a.a. ~ 565 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LRDKTVMIIVAISPKYKQDVEGAESQLDEDEHGLHTKYIHRMMQIEFIKQGSMNFRFIPVLFPNAKKEHVPTWLQNTHVYSWPKNKKNILLRLLREEEYVAPPRGPLPTLQVVPL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top