Advanced Search



Monoclonal Anti-FGL2 antibody produced in mouse

SIGMA/WH0010875M1 - clone 6D9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-T49; Anti-fibrinogen-like 2; Anti-pT49

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0010875M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to FGL2 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5 μg/mL]
Western Blotting FGL2 monoclonal antibody, clone 6D9. Western Blot analysis of FGL2 expression in Raw 264.7.
Western Blotting Western Blot analysis of FGL2 expression in transfected 293T cell line by FGL2 monoclonal antibody, clone 6D9. Lanes Lane 1: FGL2 transfected lysate (50 kDa). Lane 2: Non-transfected lysate.
Western Blotting FGL2 monoclonal antibody, clone 6D9 Western Blot analysis of FGL2 expression in HeLa.
Western Blotting FGL2 monoclonal antibody, clone 6D9. Western Blot analysis of FGL2 expression in PC-12.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
Immunoprecipitation Immunoprecipitation of FGL2 transfected lysate using anti-FGL2 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with FGL2 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged FGL2 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 6D9, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_006682 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human, mouse, rat
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q14314 
Application: Monoclonal Anti-FGL2 antibody produced in mouse has been used in immunohistochemistry.
Biochem/physiol Actions: Fibrinogen-like protein 2 (FGL2) exhibits prothrombinase activity. It also shows immune regulatory activity during allograft rejection, abortion, and viral infections. This protein acts as an immune coagulant that produces thrombin directly. FGL2 through the clotting-dependent pathway may play a role in tumor angiogenesis and metastasis. It is involved in the pathogenesis of T helper type 1 (Th1) cytokine-induced fetal loss syndrome and viral-induced fulminant hepatitis. FGL2 gene is involved in modulating regulatory T cells (Treg) function. This protein regulates innate and adaptive immunity. FGL2 may serve as a therapeutic agent for glioblastoma (GBM) by promoting GBM progression.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Fibrinogen-like protein 2 (FGL2) belongs to the fibrinogen-like protein family. The FGL2 gene is located on the human chromosome at 7q11.23.
Immunogen: FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top