Advanced Search



Monoclonal Anti-KIF2C antibody produced in mouse

SIGMA/WH0011004M1 - clone 1G2, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-KNSL6; Anti-MCAK; Anti-kinesin family member 2C

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0011004M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to KIF2C on formalin-fixed paraffin-embedded human malignant lymphoma, diffuse large B. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to KIF2C on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting Western Blot analysis of KIF2C expression in transfected 293T cell line by KIF2C monoclonal antibody, clone 1G2. Lanes Lane 1: KIF2C transfected lysate (81.3 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of KIF2C over-expressed 293 cell line, cotransfected with KIF2C Validated Chimera RNAi. Blot probed with KIF2C monoclonal antibody, clone 1G2. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting KIF2C monoclonal antibody, clone 1G2 Western Blot analysis of KIF2C expression in HeLa S3 NE.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).
Immunoprecipitation Immunoprecipitation of KIF2C transfected lysate using anti-KIF2C monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with KIF2C rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged KIF2C is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1G2, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC014924 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q99661 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: The protein encoded by this gene is a member of kinesin-like protein family. Proteins of this family are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein is important for anaphase chromosome segregation and may be required to coordinate the onset of sister centromere separation. (provided by RefSeq)
Immunogen: KIF2C (AAH14924, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAMDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQKQKRRSVNSKI
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top