Monoclonal Anti-DDX20 antibody produced in mouse

SIGMA/WH0011218M1 - clone 5H5, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-DEAD (Asp-Glu-Ala-Asp) box polypeptide 20; Anti-DKFZp434H052; Anti-DP103; Anti-GEMIN3

MDL Number: MFCD06412249
Product Type: Chemical

Catalog Number	PKG Qty.	Price


45-WH0011218M1-100UG	100 µg	$524.00 1/EA	Add To Favorites

Immunofluorescence Immunofluorescence of monoclonal antibody to DDX20 on HeLa cell. [antibody concentration 10 μg/mL]

ELISA Detection limit for recombinant GST tagged DDX20 is approximately 0.3 ng/mL as a capture antibody.

Properties
Descriptions
Safety Info.
Basic Data

antibody form	purified immunoglobulin
antibody product type	primary antibodies
biological source	mouse
clone	5H5, monoclonal
conjugate	unconjugated
form	buffered aqueous solution
GenBank^® accession no.	NM_007204
isotype	IgG2aκ
Quality Level	100
shipped in	dry ice
species reactivity	human
storage temp.	−20°C
technique(s)	immunofluorescence: suitable
	indirect ELISA: suitable
UniProt accession no.	Q9UHI6

Biochem/physiol Actions:	The gene DDX20 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 20) encodes a RNA helicase that forms a part of the SMN (survival-of-motor-neurons) complex, which is involved in the processing and assembly of RNPs (ribonucleoproteins), such as, snRNPs (spliceosomes), snoRNPs, miRNPs, hnRNPs and transcriptosomes. It plays an essential role in early embryonic development, where it is involved in silencing of maternal transcripts and processing of RNA. DDX20 plays a part in hind brain development where it suppresses the transcription of Egr2 (early growth response 2) gene. It regulates macrophage differentiation and proliferation by silencing the expression of Ets target genes involved in Ras pathway. It also acts as a cofactor in the SUMOylation of SF-1 (steroidogenic factor 1) by PIASy (protein inhibitor of activated STAT Y). This protein facilitates the assembly of the core of SMN complex, and this activity of DDX20 is associated with spinal muscular atrophy (SMA). DDX20 acts as an oncogene that facilitates metastasis, in human breast cancer, and has potential as a therapeutic target for the same.
Features and Benefits:	Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
General description:	DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which has an ATPase activity and is a component of the survival of motor neurons (SMN) complex. This protein interacts directly with SMN, the spinal muscular atrophy gene product, and may play a catalytic role in the function of the SMN complex on RNPs. (provided by RefSeq)
Immunogen:	DDX20 (NP_009135, 725 a.a. ~ 824 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence EGASQRAKQSRRNLPRRSSFRLQTEAQEDDWYDCHREIRLSFSDTYQDYEEYWRAYYRAWQEYYAAASHSYYWNAQRHPSWMAAYHMNTIYLQEMMHSNQ
Legal Information:	GenBank is a registered trademark of United States Department of Health and Human Services
Physical form:	Solution in phosphate buffered saline, pH 7.4

RIDADR	NONH for all modes of transport
Flash Point(F)	Not applicable
Flash Point(C)	Not applicable

Storage Temp.	−20°C
UNSPSC	12352203

To Order From a Quote