Advanced Search



Monoclonal Anti-POMZP3 antibody produced in mouse

SIGMA/WH0022932M2 - clone 2E7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-MGC8359; Anti-POM (POM121 homolog, rat) and ZP3 fusion; Anti-POM121; Anti-POMZP3

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0022932M2-100UG 100 µg
$580.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to POMZP3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 μg/mL]
Western Blotting POMZP3 monoclonal antibody, clone 2E7. Western Blot analysis of POMZP3 expression in PC-12.
Western Blotting POMZP3 monoclonal antibody, clone 2E7 Western Blot analysis of POMZP3 expression in K-562.
Western Blotting QC Western Blot detection against Immunogen (31.83 kDa).
ELISA Detection limit for recombinant GST tagged POMZP3 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2E7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_152992 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity rat, mouse, human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q6PJE2 
General description: This gene appears to have resulted from a fusion of DNA sequences derived from 2 distinct loci, specifically through the duplication of two internal exons from the POM121 gene and four 3′ exons from the ZP3 gene. The 5′ end of this gene is similar to the 5` coding region of the POM121 gene which encodes an integral nuclear pore membrane protein. However, the protein encoded by this gene lacks the nuclear pore localization motif. The 3′ end of this gene is similar to the last 4 exons of the zona pellucida glycoprotein 3 (ZP3) gene and the encoded protein retains one zona pellucida domain. Multiple protein isoforms are encoded by transcript variants of this gene. (provided by RefSeq)
Immunogen: POMZP3 (NP_694537, 64 a.a. ~ 116 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DQIFLDGQENKRSCLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNM*
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top