Advanced Search



Monoclonal Anti-PHGDH antibody produced in mouse

SIGMA/WH0026227M1 - clone 4A3-1D6, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-3PGDH; Anti-MGC3017; Anti-PDG; Anti-PGAD; Anti-PGD; Anti-PGDH; Anti-SERA; Anti-phosphoglycerate dehydrogenase

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0026227M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 1 ~ 10 μg/mL]
Immunohistochemistry Immunoperoxidase of monoclonal antibody to PHGDH on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to PHGDH on HeLa cell. [antibody concentration 1 ~ 10 μg/mL]
Western Blotting PHGDH monoclonal antibody, clone 4A3-1D6. Western Blot analysis of PHGDH expression in human liver.
Western Blotting PHGDH monoclonal antibody, clone 4A3-1D6 Western Blot analysis of PHGDH expression in Jurkat.
Western Blotting Western Blot analysis of PHGDH expression in transfected 293T cell line by PHGDH monoclonal antibody, clone 4A3-1D6. Lanes Lane 1: PHGDH transfected lysate (56.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting PHGDH monoclonal antibody, clone 4A3-1D6. Western Blot analysis of PHGDH expression in A-431.
Western Blotting QC Western Blot detection against Immunogen (84.37 kDa).
Immunoprecipitation Immunoprecipitation of PHGDH transfected lysate using anti-PHGDH monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with PHGDH rabbit polyclonal antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4A3-1D6, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC011262 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. O43175 
Application: Monoclonal Anti-PHGDH antibody produced in mouse has been used in Western Blotting.
Biochem/physiol Actions: The gene PHGDH (D-3-phosphoglycerate dehydrogenase) is mapped to human chromosome 1p. The enzyme is mainly responsible for catalyzing initial step of the serine synthesis pathway, converting 3-phosphoglycerate into 3-phosphohydroxypyruvate. It is up-regulated in estrogen receptor-negative breast cancers, melanoma and cervical cancers. Mutations in the gene encoding PHGDH are associated with Neu-Laxova syndrome. Down-regulation in PHGDH levels results in congenital microcephaly, psychomotor retardation and seizures.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Immunogen: PHGDH (AAH11262.1, 1 a.a. ~ 533 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAFANLRKVLISDSLDPCCRKILQDGGLQVVEKQNLSKEELIAELQDCEGLIVRSATKVTADVINAAEKLQVVGRAGTGVDNVDLEAATRKGILVMNTPNGNSLSAAELTCGMIMCLARQIPQATASMKDGKWERKKFMGTELNGKTLGILGLGRIGREVATRMQSFGMKTIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCKKGVRVVNCARGGIVDEGALLRALQSGQCAGAALDVFTEEPPRDRALVDHENVISCPHLGASTKEAQSRCGEEIAVQFVDMVKGKSLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMRAWAGSPKGTIQVITQGTSLKNAGNCLSPAVIVGLLKEASKQADVNLVNAKLLVKEAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRRDLPLLLFRTQTSDPAMLPTMIGLLAEAGVRLLSYQTSLVSDGETWHVMGISSLLPSLEAWKQHVTEAFQFHF
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top