Advanced Search



Monoclonal Anti-KCNIP2 antibody produced in mouse

SIGMA/WH0030819M1 - clone 3E7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-DKFZp566L1246; Anti-KCHIP2; Anti-Kv channel interacting protein 2; Anti-MGC17241

MDL Number: MFCD05865350
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0030819M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to KCNIP2 on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 1.5 μg/mL]
Western Blotting Western Blot analysis of KCNIP2 expression in transfected 293T cell line by KCNIP2 monoclonal antibody, clone 3E7. Lanes Lane 1: KCNIP2 transfected lysate (30.919 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of KCNIP2 over-expressed 293 cell line, cotransfected with KCNIP2 Validated Chimera RNAi. Blot probed with KCNIP2 monoclonal antibody, clone 3E7. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3E7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. BC034685 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q9NS61 
General description: This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belongs to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified from this gene. (provided by RefSeq)
Immunogen: KCNIP2 (AAH34685, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSENSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNEC
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top