Advanced Search



Monoclonal Anti-SSH3 antibody produced in mouse

SIGMA/WH0054961M1 - clone 6F9, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-FLJ10928; Anti-FLJ20515; Anti-SSH3; Anti-slingshot homolog 3 (Drosophila)

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0054961M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to SSH3 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 1 ~ 10 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to SSH3 on A-431 cell. [antibody concentration 10 μg/mL]
Western Blotting SSH3 monoclonal antibody, clone 6F9 Western Blot analysis of SSH3 expression in A-431.
Western Blotting Western Blot analysis of SSH3 expression in transfected 293T cell line by SSH3 monoclonal antibody, clone 6F9. Lanes Lane 1: SSH3 transfected lysate (73 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.63 kDa).
Immunoprecipitation Immunoprecipitation of SSH3 transfected lysate using anti-SSH3 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with SSH3 monoclonal antibody.
ELISA Detection limit for recombinant GST tagged SSH3 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 6F9, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_017857 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q8TE77 
Biochem/physiol Actions: SSH3 (Slingshot protein phosphatase 3) is involved in the actin filament assembly. During actin reorganization, LIM-kinase 1 (LIMK1) restricts the activity of ADF (actin-depolymerizing factor)/cofilin, which is a stimulus-responsive mediator of actin dynamics. SSH3 blocks the LIMK1 functions and reactivates ADF/cofilin in vivo by the dephosphorylating it. In addition, it is also involved in several cellular and developmental activities.
General description: The ADF (actin-depolymerizing factor)/cofilin family (see MIM 601442) is composed of stimulus-responsive mediators of actin dynamics. ADF/cofilin proteins are inactivated by kinases such as LIM domain kinase-1 (LIMK1; MIM 601329). The SSH family appears to play a role in actin dynamics by reactivating ADF/cofilin proteins in vivo (Niwa et al., 2002 [PubMed 11832213]).[supplied by OMIM
Immunogen: SSH3 (NP_060327, 293 a.a. ~ 391 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SKEIRQALELRLGLPLQQYRDFIDNQMLLLVAQRDRASRIFPHLYLGSEWNAANLEELQRNRVTHILNMAREIDNFYPERFTYHNVRLWDEESAQLLPH
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top