Advanced Search



Monoclonal Anti-PCDHGA2 antibody produced in mouse

SIGMA/WH0056113M1 - clone 2A7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-PCDHGAMMAA2; Anti-protocadherin gamma subfamily A, 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0056113M1-50UG 50 µg
$406.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of PCDHGA2 expression in transfected 293T cell line by PCDHGA2 monoclonal antibody, clone 2A7. Lanes Lane 1: PCDHGA2 transfected lysate (90.3 kDa). Lane 2: Non-transfected lysate.
Western Blotting PCDHGA2 monoclonal antibody, clone 2A7. Western Blot analysis of PCDHGA2 expression in Raw 264.7.
Enhanced Validation-RNAi Western blot analysis of PCDHGA2 over-expressed 293 cell line, cotransfected with PCDHGA2 Validated Chimera RNAi. Blot probed with PCDHGA2 monoclonal antibody, clone 2A7. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (37.73 kDa).
ELISA Detection limit for recombinant GST tagged PCDHGA2 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 2A7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_018915 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity mouse
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
General description: This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes. (provided by RefSeq)
Immunogen: PCDHGA2 (NP_061738, 223 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SGTSRICVKVLDANDNAPVFTQPEYRISIPENTLVGTRILTVTATDADEGYYAQVVYFLEKSPGETSEVFELKSTSGELTIIKDLDYEDATFHEIDIEAQDGPGLLTRA
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top