Advanced Search



Monoclonal Anti-AGTRAP antibody produced in mouse

SIGMA/WH0057085M2 - clone 1G2, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ATRAP; Anti-angiotensin II receptor-associated protein

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0057085M2-100UG 100 µg
$406.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to AGTRAP on formalin-fixed paraffin-embedded human prostate. [antibody concentration 0.8 μg/mL]
Western Blotting Western Blot analysis of AGTRAP expression in transfected 293T cell line by AGTRAP monoclonal antibody, clone 1G2. Lanes Lane 1: AGTRAP transfected lysate (16.7 kDa). Lane 2: Non-transfected lysate.
Western Blotting AGTRAP monoclonal antibody, clone 1G2 Western Blot analysis of AGTRAP expression in HeLa S3 NE.
Enhanced Validation-RNAi Western blot analysis of AGTRAP over-expressed 293 cell line, cotransfected with AGTRAP Validated Chimera RNAi. Blot probed with AGTRAP monoclonal antibody, clone 1G2. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (31.46 kDa).
ELISA Detection limit for recombinant GST tagged AGTRAP is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1G2, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_020350 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q6RW13 
General description: This gene encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. (provided by RefSeq)
Immunogen: AGTRAP (NP_065083, 108 a.a. ~ 159 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
HMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGS
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top