Advanced Search



Monoclonal Anti-SMURF1 antibody produced in mouse

SIGMA/WH0057154M1 - clone 1D7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-KIAA1625; Anti-SMAD specific E3 ubiquitin protein ligase 1

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0057154M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to SMURF1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 2 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to SMURF1 on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting SMURF1 monoclonal antibody, clone 1D7. Western Blot analysis of SMURF1 expression in HeLa.
Western Blotting SMURF1 monoclonal antibody, clone 1D7. Western Blot analysis of SMURF1 expression in HepG2.
Western Blotting Western Blot analysis of SMURF1 expression in transfected 293T cell line by SMURF1 monoclonal antibody, clone 1D7. Lanes Lane 1: SMURF1 transfected lysate (83.4 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.18 kDa).
Immunoprecipitation Immunoprecipitation of SMURF1 transfected lysate using anti-SMURF1 monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with SMURF1 rabbit polyclonal antibody.
ELISA Detection limit for recombinant GST tagged SMURF1 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1D7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_020429 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity rat, mouse, human
storage temp. −20°C
technique(s) immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q9HCE7 
Application: Monoclonal Anti-SMURF1 antibody produced in mouse has been used in Western Blotting.
Biochem/physiol Actions: SMAD specific E3 ubiquitin protein ligase 1 (SMURF1) acts as a negative regulator of transforming growth factor β (TGFβ) pathway. It has a role in the nuclear export of mothers against decapentaplegic homolog 7 (SMAD7) and the degradation of SMAD4. During epithelial-mesenchymal transition, SMURF1 dissolves tight junctions in cells. This protein also has a role in cell migration and in the bone morphogenetic protein pathway. SMURF1 has been associated with hepatocellular carcinoma.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: SMAD specific E3 ubiquitin protein ligase 1 (SMURF1) is an E3 ubiquitin ligase and the gene encoding it is localized on human chromosome 7q22.1.
Immunogen: SMURF1 (NP_065162, 165 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DSGPGRPLSCFMEEPAPYTDSTGAAAGGGNCRFVESPSQDQRLQAQRLRNPDVRGSLQTPQNRPHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIP
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top