Advanced Search



Monoclonal Anti-POLD4 antibody produced in mouse

SIGMA/WH0057804M1 - clone 2B11, ascites fluid

Synonym: Anti-POLDS; Anti-p12; Anti-polymerase (DNA-directed), delta 4

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0057804M1-200UL 200 µL
$580.00
1/EA
Add To Favorites
Western Blotting QC Western Blot detection against Immunogen (29.48 kDa).
ELISA Detection limit for recombinant GST tagged POLD4 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form ascites fluid
antibody product type primary antibodies
biological source mouse
clone 2B11, monoclonal
conjugate unconjugated
GenBank accession no. BC001334 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1:500-1:1000
UniProt accession no. Q9HCU8 
Biochem/physiol Actions: DNA polymerase (Pol) δ plays a vital role in DNA replication, DNA repair processes and genetic recombination. POLD4 stabilizes the Pol δ holoenzyme. In addition, it also facilitates pol δ-PCNA complex stabilization. Proteolysis of POLD4 in response to DNA damage leads to the consequent conversion of the holoenzyme pol δ4 to the heterotrimer pol δ3. Pol δ3 acts as an antimutator polymerase and is supposed to enhance surveillance against mutagenesis. Downregulated expression of the gene is associated with the genomic instability in lung cancer.
General description: DNA polymerase δ 4 (POLD4), also known as p12, is the smallest subunit of DNA polymerase (Pol) δ. It is encoded by the gene mapped to human chromosome 11q13.2.
General description: The DNA polymerase delta complex is involved in DNA replication and repair, and it consists of the proliferating cell nuclear antigen (PCNA; MIM 176740), the multisubunit replication factor C (see MIM 102579), and the 4 subunit polymerase complex: POLD1 (MIM 174761), POLD2 (MIM 600815), POLD3 (MIM 611415), and POLD4 (Liu and Warbrick, 2006 [PubMed 16934752]).
Immunogen: POLD4 (AAH01334, 1 a.a. ~ 34 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGRKRLITDSYPVVKRREGPAGHSKGELAPELGL
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top