Advanced Search



Monoclonal Anti-PYCRL antibody produced in mouse

SIGMA/WH0065263M1 - clone 4F11, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-FLJ13852; Anti-pyrroline-5-carboxylate reductase-like

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0065263M1-100UG 100 µg
$406.00
1/EA
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to PYCRL on HeLa cell. [antibody concentration 10 μg/mL]
Western Blotting PYCRL monoclonal antibody, clone 4F11 Western Blot analysis of PYCRL expression in HeLa.
Western Blotting Western Blot analysis of PYCRL expression in transfected 293T cell line by PYCRL monoclonal antibody, clone 4F11. Lanes Lane 1: PYCRL transfected lysate (Predicted MW: 28.6 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (36.74 kDa).
Immunoprecipitation Immunoprecipitation of PYCRL transfected lysate using anti-PYCRL monoclonal antibody and Protein A Magnetic Bead , and immunoblotted with PYCRL monoclonal antibody.
ELISA Detection limit for recombinant GST tagged PYCRL is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4F11, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_023078 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) immunoprecipitation (IP): suitable
  indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
Immunogen: PYCRL (NP_075566, 32 a.a. ~ 131 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KVEAQHILASAPTDRNLCHFQALGCRTTHSNQEVLQSCLLVIFATKPHVLPAVLAEVAPVVTTEHILVSVAAGVSLSTLEELLPPNTRVLRVLPNLPCVV
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top