Advanced Search



Monoclonal Anti-ALG12 antibody produced in mouse

SIGMA/WH0079087M6 - clone 5E3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-ECM39; Anti-MGC111358; Anti-MGC3136; Anti-PP14673; Anti-asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase); Anti-hALG12

Product Type: Chemical
Catalog Number PKG Qty. Price Quantity
45-WH0079087M6-100UG 100 µg
 $406.00
1/EA		 Add To Favorites
Western Blotting ALG12 monoclonal antibody, clone 5E3 Western Blot analysis of ALG12 expression in HeLa.
Western Blotting ALG12 monoclonal antibody, clone 5E3. Western Blot analysis of ALG12 expression in PC-12.
Western Blotting QC Western Blot detection against Immunogen (32.01 kDa).
ELISA Detection limit for recombinant GST tagged ALG12 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 5E3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_024105 
isotype IgG1κ
Quality Level 100 
shipped in dry ice
species reactivity rat, human, mouse
storage temp. −20°C
target post-translational modification glycosylation
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q9BV10 
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. (provided by RefSeq)
Immunogen: ALG12 (NP_077010, 369 a.a. ~ 425 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:
Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top