Advanced Search



Monoclonal Anti-CARD14 antibody produced in mouse

SIGMA/WH0079092M1 - clone 4B3, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-BIMP2; Anti-CARMA2; Anti-caspase recruitment domain family, member 14

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0079092M1-100UG 100 µg
$580.00
1/EA
Add To Favorites
ELISA Detection limit for recombinant GST tagged CARD14 is approximately 0.1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4B3, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_024110 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
UniProt accession no. Q9BXL6 
Biochem/physiol Actions: The gene CARD14 (caspase recruitment domain family member 14) encodes a nuclear factor that contains a CARD domain involved in binding to the CARD domain of BCL10 (B cell leukemia 10), a protein involved in the activation of NF-κB through the IKK complex, and positive regulation of apoptosis. Mutations in this gene are associated with familial pityriasis rubra pilaris, a papulosquamous disorder phenotypically related to psoriasis. It also activates p38 and JNK MAP (c-Jun N-terminal kinase mitogen-activated protein) kinase pathways via association with paracaspase-1 (PCASP-1), also referred to as MALT1, which can serve as a therapeutic target in psoriasis.
General description: The protein encoded by this gene belongs to the membrane-associated guanylate kinase (MAGUK) family, a class of proteins that functions as molecular scaffolds for the assembly of multiprotein complexes at specialized regions of the plasma membrane. This protein is also a member of the CARD protein family, which is defined by carrying a characteristic caspase-associated recruitment domain (CARD). This protein shares a similar domain structure with CARD11 protein. The CARD domains of both proteins have been shown to specifically interact with BCL10, a protein known to function as a positive regulator of cell apoptosis and NF-kappaB activation. When expressed in cells, this protein activated NF-kappaB and induced the phosphorylation of BCL10. Two alternatively spliced variants of this gene encoding distinct isoforms have been reported. (provided by RefSeq)
Immunogen: CARD14 (NP_077015, 905 a.a. ~ 1004 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
VQLDSVCTLHRMDIFPIVIHVSVNEKMAKKLKKGLQRLGTSEEQLLEAARQEEGDLDRAPCLYSSLAPDGWSDLDGLLSCVRQAIADEQKKVVWTEQSPR
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top