Advanced Search



Monoclonal Anti-ITCH antibody produced in mouse

SIGMA/WH0083737M6 - clone 1B8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-AIF4; Anti-AIP4; Anti-NAPP1; Anti-dJ468O1.1; Anti-itchy homolog E3 ubiquitin protein ligase (mouse)

MDL Number: MFCD02263548
Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0083737M6-100UG 100 µg
$0.00
1/EA
CALL FOR PRICE
Add To Favorites
Immunofluorescence Immunofluorescence of monoclonal antibody to ITCH on HeLa cell. [antibody concentration 10 μg/mL]
ELISA Detection limit for recombinant GST tagged ITCH is 1 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 1B8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_031483 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) immunofluorescence: suitable
  indirect ELISA: suitable
UniProt accession no. Q96J02 
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: Atrophin-1 contains a polyglutamine repeat, expansion of which is responsible for dentatorubral and pallidoluysian atrophy. The protein encoded by this gene interacts with atrophin-1. This encoded protein is a closely related member of the NEDD4-like protein family. This family of proteins are E3 ubiquitin-ligase molecules and regulate key trafficking decisions, including targeting of proteins to proteosomes or lysosomes. This encoded protein contains four tandem WW domains and a HECT (homologous to the E6-associated protein carboxyl terminus) domain. It can act as a transcriptional corepressor of p45/NFE2 and may participate in the regulation of immune responses by modifying Notch-mediated signaling. It is highly similar to the mouse Itch protein, which has been implicated in the regulation and differentiation of erythroid and lymphoid cells. (provided by RefSeq)
Immunogen: ITCH (NP_113671, 92 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DVLLGTAALDIYETLKSNNMKLEEVVVTLQLGGDKEPTETIGDLSICLDGLQLESEVVTNGETTCSESASQNDDGSRSKDETRVSTNGSDDPEDAGAGE
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top