Advanced Search



Monoclonal Anti-CGB2 antibody produced in mouse

SIGMA/WH0114336M2 - clone 4F8, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-chorionic gonadotropin, beta polypeptide 2

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0114336M2-50UG 50 µg
$406.00
1/EA
Add To Favorites
Immunoblotting Monoclonal Anti-CGB2, Cat. No. WH0114336M2 used at the antibody concentration: 1 μg/mL. Specific band of ~32.27 kDa using immunogen protein lysate.
Western Blotting QC Western Blot detection against Immunogen (31.9 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 4F8, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_033378 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q6NT52 
General description: The beta subunit of chorionic gonadotropin (CGB) is encoded by six highly homologous and structurally similar genes that are arranged in tandem and inverted pairs on chromosome 19q13.3, and contiguous with the luteinizing hormone beta (LHB) subunit gene. The CGB genes are primarily distinguished by differences in the 5′ untranscribed region. This gene was originally thought to be one of the two pseudogenes (CGB1 and CGB2) of CGB subunit, however, detection of CGB1 and CGB2 transcripts in vivo, and their presence on the polysomes, suggested that these transcripts are translated. To date, a protein product corresponding to CGB2 has not been isolated. The deduced sequence of the hypothetical protein of 132 aa does not share any similarity with that of functional CGB subunits (PMID:8954017). However, a 163 aa protein, translated from a different frame, is about the same size, and shares 98% identity with other CGB subunits. (provided by RefSeq)
Immunogen: CGB2 (NP_203696, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MSTSPVLAEDIPLRERHVKGAAAVAAAEHGRDMGIQGAASATVPPHQCHPGCGEGG
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top