Advanced Search



Monoclonal Anti-GPR175 antibody produced in mouse

SIGMA/WH0131601M1 - clone 6D7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-G protein-coupled receptor 175; Anti-TPRA40

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0131601M1-100UG 100 µg
$406.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of GPR175 expression in transfected 293T cell line by GPR175 monoclonal antibody, clone 6D7. Lanes Lane 1: GPR175 transfected lysate (41.053 kDa). Lane 2: Non-transfected lysate.
Enhanced Validation-RNAi Western blot analysis of GPR175 over-expressed 293 cell line, cotransfected with GPR175 Validated Chimera RNAi. Blot probed with GPR175 monoclonal antibody, clone 6D7. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (35.75 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 6D7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_016372 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
Immunogen: GPR175 (NP_057456, 281 a.a. ~ 371 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
RGFFGSEPKILFSYKCQVDETEEPDVHLPQPYAVARREGLEAAGAAGASAASYSSTQFDSAGGVAYLDDIASMPCHTGSINSTDSERWKAI
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top