Advanced Search



Monoclonal Anti-RNF168 antibody produced in mouse

SIGMA/WH0165918M1 - clone 3E1, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-FLJ35794; Anti-ring finger protein 168

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0165918M1-100UG 100 µg
$524.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to RNF168 on formalin-fixed paraffin-embedded human prostate cancer. [antibody concentration 1.5 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to RNF168 on HepG2 cell. [antibody concentration 10 μg/mL]
Western Blotting RNF168 monoclonal antibody, clone 3E1 Western Blot analysis of RNF168 expression in HepG2.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
ELISA Detection limit for recombinant GST tagged RNF168 is 0.03 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 3E1, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_152617 
isotype IgG2bκ
Quality Level 100 
shipped in dry ice
species reactivity human, mouse, rat
storage temp. −20°C
technique(s) indirect ELISA: suitable
  indirect immunofluorescence: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q8IYW5 
Biochem/physiol Actions: Ring finger protein 168 (RNF168) associates with ubiquitinated histone H2A. It has an important role in the ubiquitination pathway and binds to the conjugated ubiquitin on damaged chromosomes.
General description: The complex repair response elicited by DNA double-strand breaks (DSBs) includes recruitment of several DNA repair proteins and ubiquitination of H2A-type histones (see MIM 142720). RNF168 is an E3 ubiquitin ligase critical for DSB repair (Stewart et al., 2009 [PubMed 19203578]).[supplied by OMIM
Immunogen: RNF168 (NP_689830, 462 a.a. ~ 571 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVPNRQKGSPDEYHLRATSSPPDKVLNGQRKNPKDGNFKRQTHTKHPTPERGSRDKNRQVSLKMQLKQSVNRRKMPNSTRDHCKVSKSAHSLQPSISQKSVFQMFQRCTK
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top