Advanced Search



Monoclonal Anti-MGC26963 antibody produced in mouse

SIGMA/WH0166929M8 - clone 7D10, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-hypothetical protein MGC26963

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0166929M8-100UG 100 µg
$524.00
1/EA
Add To Favorites
Western Blotting Western Blot analysis of MGC26963 expression in transfected 293T cell line by MGC26963 monoclonal antibody, clone 7D10. Lanes Lane 1: MGC26963 transfected lysate (42.3 kDa). Lane 2: Non-transfected lysate.
Western Blotting MGC26963 monoclonal antibody, clone 7D10. Western Blot analysis of SGMS2 expression in human stomach.
Enhanced Validation-RNAi Western blot analysis of MGC26963 over-expressed 293 cell line, cotransfected with MGC26963 Validated Chimera RNAi. Blot probed with MGC26963 monoclonal antibody, clone 7D10. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting QC Western Blot detection against Immunogen (34.43 kDa).

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 7D10, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank® accession no. NM_152621 
isotype IgG2aκ
Quality Level 100 
shipped in dry ice
species reactivity human
storage temp. −20°C
technique(s) indirect ELISA: suitable
  western blot: 1-5 μg/mL
UniProt accession no. Q8NHU3 
Biochem/physiol Actions: Sphingomyelin synthase 2 (SGMS2) or MGC26963 takes part in the biosynthesis of sphingomyelin, primarily in the plasma membrane. It also possesses a ceramide phosphoethanolamine synthase activity.
Features and Benefits: Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more. 
General description: Sphingomyelin, a major component of cell and Golgi membranes, is made by the transfer of phosphocholine from phosphatidylcholine onto ceramide, with diacylglycerol as a side product. The protein encoded by this gene is an enzyme that catalyzes this reaction primarily at the cell membrane. The synthesis is reversible, and this enzyme can catalyze the reaction in either direction. The encoded protein is required for cell growth. Three transcript variants encoding the same protein have been found for this gene. There is evidence for more variants, but the full-length nature of their transcripts has not been determined
Immunogen: MGC26963 (NP_689834, 2 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Year Price Updates

We are currently working diligently to update our website pricing information for the New Year. If you place an order, you will be acknowledged with any corrected pricing. If you'd like the most current information sooner, please don't hesitate to drop us an email or give us a call and we'd be happy to assist. Thank you for your patience while we are updating.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top