Advanced Search



Monoclonal Anti-PIP5K3 antibody produced in mouse

SIGMA/WH0200576M1 - clone 6C7, purified immunoglobulin, buffered aqueous solution

Synonym: Anti-CFD; Anti-KIAA0981; Anti-MGC40423; Anti-PIKfyve; Anti-PIP5K; Anti-p235; Anti-phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III

Product Type: Chemical

Catalog Number PKG Qty. Price Quantity
45-WH0200576M1-100UG 100 µg
$406.00
1/EA
Add To Favorites
Immunohistochemistry Immunoperoxidase of monoclonal antibody to PIP5K3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 μg/mL]
Immunofluorescence Immunofluorescence of monoclonal antibody to PIP5K3 on HeLa cell. [antibody concentration 10 μg/mL]
Enhanced Validation-RNAi Western blot analysis of PIP5K3 over-expressed 293 cell line, cotransfected with PIP5K3 Validated Chimera RNAi. Blot probed with PIP5K3 monoclonal antibody, clone 6C7. GAPDH (36.1 kDa) used as specificity and loading control.
Western Blotting Western Blot analysis of PIP5K3 expression in transfected 293T cell line by PIP5K3 monoclonal antibody, clone 6C7. Lanes Lane 1: PIP5K3 transfected lysate (50.2 kDa). Lane 2: Non-transfected lysate.
Western Blotting QC Western Blot detection against Immunogen (37.84 kDa).
ELISA Detection limit for recombinant GST tagged PIP5K3 is approximately 0.3 ng/mL as a capture antibody.

 

antibody form purified immunoglobulin
antibody product type primary antibodies
biological source mouse
clone 6C7, monoclonal
conjugate unconjugated
form buffered aqueous solution
GenBank accession no. NM_152671 
isotype IgG2aκ
shipped in dry ice
species reactivity human
storage temp. −20°C
target post-translational modification unmodified
technique(s) capture ELISA: suitable
  ELISA: suitable
  immunofluorescence: suitable
  immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
  western blot: 1-5 μg/mL
Biochem/physiol Actions: Phosphatidylinositol-3-phosphate/phosphatidylinositol-5-kinase, type III (PIP5K3) is involved in the synthesis of phosphatidylinositol 3, 5-bisphosphate. It also possesses a protein kinase activity. PIP5K3 regulates specific signaling pathways as well as membrane trafficking. Mutations in the gene encoding it are associated with fleck corneal dystrophy.
Disclaimer: Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
General description: PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM
Immunogen: PIP5K3 (NP_689884, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR
Legal Information: GenBank is a registered trademark of United States Department of Health and Human Services
Physical form: Solution in phosphate buffered saline, pH 7.4
RIDADR NONH for all modes of transport
WGK Germany nwg
Flash Point(F) Not applicable
Flash Point(C) Not applicable
Storage Temp. −20°C
UNSPSC 12352203

The following items have been added to your cart:

Choose a favorite list for this item:

Catalog Number Description Price
$

Returns/Order support

Please fill out the form below if you want to request order support from Krackeler Scientific.


Quick Order

* Required


New Tariffs & Effects on Pricing

Tariff note: As we navigate the current environment of tariff surcharges and mid-year manufacturer price increases, we want to keep you informed. While we have avoided making specific decisions thus far, we anticipate that we will be forced to implement a cost adjustment policy to offset the fees we have already been absorbing. We are committed to transparency and moderation in this process.

800-334-7725
office@krackeler.com


Play Video

To Request a Quote

  1. Search or Browse for items and add to them to your Shopping Cart.
  2. Click the "Request Quote" button at the bottom of the Shopping Cart page.
  3. Fill out required fields.
  4. Optionally you can convert to standard checkout mode by choosing a payment type.
  5. Click "Request Quote" at the bottom of the page.

You will be contacted with a quote.

To Order From a Quote

  1. Register and login to the website.
  2. Receive a quote from your sales representative or customer service.
  3. Have your copy of the quote in hand.
  4. Visit our quote module to search for your quote.
Back to Top